UXT antibody (70R-1211)

Rabbit polyclonal UXT antibody raised against the N terminal of UXT

Synonyms Polyclonal UXT antibody, Anti-UXT antibody, ART-27 antibody, Ubiquitously-Expressed Transcript antibody
Specificity UXT antibody was raised against the N terminal of UXT
Cross Reactivity Human,Dog
Applications WB
Immunogen UXT antibody was raised using the N terminal of UXT corresponding to a region with amino acids MATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAKYL
Assay Information UXT Blocking Peptide, catalog no. 33R-5784, is also available for use as a blocking control in assays to test for specificity of this UXT antibody

Images

Western Blot analysis using UXT antibody (70R-1211)

UXT antibody (70R-1211) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of UXT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance UXT is a novel protein which is highly conserved in mouse. It interacts with the N-terminus of the androgen receptor and plays a role in facilitating receptor-induced transcriptional activation. It is also likely to be involved in tumorigenesis as it is abundantly expressed in tumor tissues.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using UXT antibody (70R-1211) | UXT antibody (70R-1211) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors