VDAC3 antibody (70R-5051)

Rabbit polyclonal VDAC3 antibody raised against the N terminal of VDAC3

Synonyms Polyclonal VDAC3 antibody, Anti-VDAC3 antibody, HD-VDAC3 antibody, VDAC-3, VDAC3, VDAC 3, VDAC-3 antibody, Voltage-Dependent Anion Channel 3 antibody, VDAC 3 antibody
Specificity VDAC3 antibody was raised against the N terminal of VDAC3
Cross Reactivity Human,Mouse
Applications WB
Immunogen VDAC3 antibody was raised using the N terminal of VDAC3 corresponding to a region with amino acids KWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCF
Assay Information VDAC3 Blocking Peptide, catalog no. 33R-4733, is also available for use as a blocking control in assays to test for specificity of this VDAC3 antibody


Western Blot analysis using VDAC3 antibody (70R-5051)

VDAC3 antibody (70R-5051) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VDAC3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance VDAC3 belongs to a group of mitochondrial membrane channels involved in translocation of adenine nucleotides through the outer membrane. These channels may also function as a mitochondrial binding site for hexokinase and glycerol kinase.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using VDAC3 antibody (70R-5051) | VDAC3 antibody (70R-5051) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors