VGLL3 antibody (70R-3560)

Rabbit polyclonal VGLL3 antibody

Synonyms Polyclonal VGLL3 antibody, Anti-VGLL3 antibody, FLJ38507 antibody, VGLL 3 antibody, VGL3 antibody, VGLL-3 antibody, VGLL-3, VGL-3 antibody, DKFZp686O1845 antibody, VGLL 3, VGLL3, Vestigial Like 3 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen VGLL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGLQHQDKSKESPWY
Assay Information VGLL3 Blocking Peptide, catalog no. 33R-1663, is also available for use as a blocking control in assays to test for specificity of this VGLL3 antibody


Western Blot analysis using VGLL3 antibody (70R-3560)

VGLL3 antibody (70R-3560) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VGLL3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance VGLL3 belongs to the vestigial family. It may act as a specific coactivator for the mammalian TEFs.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using VGLL3 antibody (70R-3560) | VGLL3 antibody (70R-3560) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors