VIPAR antibody (70R-3631)

Rabbit polyclonal VIPAR antibody raised against the middle region of VIPAR

Synonyms Polyclonal VIPAR antibody, Anti-VIPAR antibody, Vps33B Interacting Protein Apical-Basolateral Polarity Regulator antibody, FLJ12707 antibody
Specificity VIPAR antibody was raised against the middle region of VIPAR
Cross Reactivity Human
Applications WB
Immunogen VIPAR antibody was raised using the middle region of VIPAR corresponding to a region with amino acids VEDVDTKLNLATKFKCHDVVIDTYRDLKDRQQLLAYRSKVDKGSAEEEKI
Assay Information VIPAR Blocking Peptide, catalog no. 33R-9490, is also available for use as a blocking control in assays to test for specificity of this VIPAR antibody


Western Blot analysis using VIPAR antibody (70R-3631)

VIPAR antibody (70R-3631) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VIPAR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein is involved in the sorting of lysosomal proteins. Mutations in this gene are associated with ARCS2 (arthrogryposis, renal dysfunction, and cholestasis-2). Alternative splicing results in multiple transcript variants.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using VIPAR antibody (70R-3631) | VIPAR antibody (70R-3631) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors