VPS29 antibody (70R-5481)

Rabbit polyclonal VPS29 antibody

Synonyms Polyclonal VPS29 antibody, Anti-VPS29 antibody, VPS29, Vacuolar Protein Sorting 29 Homolog antibody, DC7 antibody, FLJ20492 antibody, DC15 antibody, VPS 29 antibody, VPS-29 antibody, VPS-29, VPS 29, PEP11 antibody, DKFZp564F0223 antibody
Cross Reactivity Human, Mouse
Applications WB
Immunogen VPS29 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGL
Assay Information VPS29 Blocking Peptide, catalog no. 33R-4834, is also available for use as a blocking control in assays to test for specificity of this VPS29 antibody

Images

Western Blot analysis using VPS29 antibody (70R-5481)

VPS29 antibody (70R-5481) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VPS29 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene belongs to a group of vacuolar protein sorting (VPS) genes that, when functionally impaired, disrupt the efficient delivery of vacuolar hydrolases. The protein encoded by this gene is a component of a large multimeric complex.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using VPS29 antibody (70R-5481) | VPS29 antibody (70R-5481) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors