VPS4A antibody (70R-2376)

Rabbit polyclonal VPS4A antibody

Synonyms Polyclonal VPS4A antibody, Anti-VPS4A antibody, FLJ22197 antibody, VPS4A, VPSA-4 antibody, Vacuolar Protein Sorting 4 Homolog A antibody, SKD2 antibody, VPSA 4 antibody, VPSA-4, VPS4-1 antibody, SKD1 antibody, VPS4 antibody, VPSA 4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen VPS4A antibody was raised using a synthetic peptide corresponding to a region with amino acids YFLHAIKYEAHSDKAKESIRAKCVQYLDRAEKLKDYLRSKEKHGKKPVKE
Assay Information VPS4A Blocking Peptide, catalog no. 33R-10096, is also available for use as a blocking control in assays to test for specificity of this VPS4A antibody


Western Blot analysis using VPS4A antibody (70R-2376)

VPS4A antibody (70R-2376) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of VPS4A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance VPS4A is a member of the AAA protein family (ATPases associated with diverse cellular activities), and is the homolog of the yeast Vps4 protein. In humans, two paralogs of the yeast protein have been identified. Functional studies indicate that both human paralogs associate with the endosomal compartments, and are involved in intracellular protein trafficking, similar to Vps4 protein in yeast.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using VPS4A antibody (70R-2376) | VPS4A antibody (70R-2376) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors