WBP2 antibody (70R-3623)

Rabbit polyclonal WBP2 antibody raised against the N terminal of WBP2

Synonyms Polyclonal WBP2 antibody, Anti-WBP2 antibody, WBP 2 antibody, WBP 2, Ww Domain Binding Protein 2 antibody, MGC18269 antibody, WBP-2, WBP2, WBP-2 antibody, WBP-2 antibody
Specificity WBP2 antibody was raised against the N terminal of WBP2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen WBP2 antibody was raised using the N terminal of WBP2 corresponding to a region with amino acids MKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQ
Assay Information WBP2 Blocking Peptide, catalog no. 33R-6156, is also available for use as a blocking control in assays to test for specificity of this WBP2 antibody

Images

Western Blot analysis using WBP2 antibody (70R-3623)

WBP2 antibody (70R-3623) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WBP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using WBP2 antibody (70R-3623) | WBP2 antibody (70R-3623) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors