WBP2NL antibody (70R-2416)

Rabbit polyclonal WBP2NL antibody raised against the N terminal of WBP2NL

Synonyms Polyclonal WBP2NL antibody, Anti-WBP2NL antibody, Wbp2 N-Terminal Like antibody, MGC26816 antibody, WBP 2, PAWP antibody, WBP 2 antibody, WBP-2, WBP2, WBP-2 antibody, FLJ26145 antibody
Specificity WBP2NL antibody was raised against the N terminal of WBP2NL
Cross Reactivity Human
Applications WB
Immunogen WBP2NL antibody was raised using the N terminal of WBP2NL corresponding to a region with amino acids MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGT
Assay Information WBP2NL Blocking Peptide, catalog no. 33R-5799, is also available for use as a blocking control in assays to test for specificity of this WBP2NL antibody


Western Blot analysis using WBP2NL antibody (70R-2416)

WBP2NL antibody (70R-2416) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WBP2NL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WBP2NL may play a role in meotic resumption and pronuclear formation, mediated by a WW domain-signaling pathway during fertilization.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using WBP2NL antibody (70R-2416) | WBP2NL antibody (70R-2416) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors