WDR12 antibody (70R-1063)

Rabbit polyclonal WDR12 antibody raised against the C terminal of WDR12

Synonyms Polyclonal WDR12 antibody, Anti-WDR12 antibody, WDR-12 antibody, WDR 12 antibody, WDR 12, WDR-12, Wd Repeat Domain 12 antibody, WDR12
Specificity WDR12 antibody was raised against the C terminal of WDR12
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen WDR12 antibody was raised using the C terminal of WDR12 corresponding to a region with amino acids DTRSCKAPLYDLAAHEDKVLSVDWTDTGLLLSGGADNKLYSYRYSPTTSH
Assay Information WDR12 Blocking Peptide, catalog no. 33R-2209, is also available for use as a blocking control in assays to test for specificity of this WDR12 antibody

Images

Western Blot analysis using WDR12 antibody (70R-1063)

WDR12 antibody (70R-1063) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of WDR12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WDR12 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. The function of this protein is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using WDR12 antibody (70R-1063) | WDR12 antibody (70R-1063) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors