WDR21A antibody (70R-1983)

Rabbit polyclonal WDR21A antibody raised against the middle region of WDR21A

Synonyms Polyclonal WDR21A antibody, Anti-WDR21A antibody, MGC46524 antibody, DKFZp434K114 antibody, WDR21 antibody, WDR-21, WDR 21 antibody, WDR 21, WDR21, MGC20547 antibody, Wd Repeat Domain 21A antibody, WDR-21 antibody
Specificity WDR21A antibody was raised against the middle region of WDR21A
Cross Reactivity Human
Applications WB
Immunogen WDR21A antibody was raised using the middle region of WDR21A corresponding to a region with amino acids GHRQSFGTNSDVLAQQFALMAPLLFNGCRSGEIFAIDLRCGNQGKGWKAT
Assay Information WDR21A Blocking Peptide, catalog no. 33R-3313, is also available for use as a blocking control in assays to test for specificity of this WDR21A antibody


Western Blot analysis using WDR21A antibody (70R-1983)

WDR21A antibody (70R-1983) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WDR21A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WDR21A is a WD repeat-containing protein. The function of WDR21A remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using WDR21A antibody (70R-1983) | WDR21A antibody (70R-1983) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors