WDR21B antibody (70R-3331)

Rabbit polyclonal WDR21B antibody raised against the middle region of WDR21B

Synonyms Polyclonal WDR21B antibody, Anti-WDR21B antibody, WDR-21, WDR21, Wd Repeat Domain 21B antibody, MGC126022 antibody, WDR 21, WDR-21 antibody, MGC126021 antibody, WDR 21 antibody
Specificity WDR21B antibody was raised against the middle region of WDR21B
Cross Reactivity Human
Applications WB
Immunogen WDR21B antibody was raised using the middle region of WDR21B corresponding to a region with amino acids HEEEGIVVAVGQDCYTRIWSLHDAHLLRTIPSPYSASEDDIPSVAFASRL
Assay Information WDR21B Blocking Peptide, catalog no. 33R-3714, is also available for use as a blocking control in assays to test for specificity of this WDR21B antibody

Images

Western Blot analysis using WDR21B antibody (70R-3331)

WDR21B antibody (70R-3331) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WDR21B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of WDR21B is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using WDR21B antibody (70R-3331) | WDR21B antibody (70R-3331) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors