WDR53 antibody (70R-4272)

Rabbit polyclonal WDR53 antibody raised against the middle region of WDR53

Synonyms Polyclonal WDR53 antibody, Anti-WDR53 antibody, WDR 53 antibody, MGC64882 antibody, WDR-53, WDR 53, Wd Repeat Domain 53 antibody, WDR53, WDR-53 antibody
Specificity WDR53 antibody was raised against the middle region of WDR53
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen WDR53 antibody was raised using the middle region of WDR53 corresponding to a region with amino acids NLLASADDSGAIKILDLENKKVIRSLKRHSNICSSVAFRPQRPQSLVSCG
Assay Information WDR53 Blocking Peptide, catalog no. 33R-6765, is also available for use as a blocking control in assays to test for specificity of this WDR53 antibody


Western Blot analysis using WDR53 antibody (70R-4272)

WDR53 antibody (70R-4272) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WDR53 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of WDR53 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using WDR53 antibody (70R-4272) | WDR53 antibody (70R-4272) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors