WDR55 antibody (70R-3310)

Rabbit polyclonal WDR55 antibody raised against the middle region of WDR55

Synonyms Polyclonal WDR55 antibody, Anti-WDR55 antibody, FLJ21702 antibody, Wd Repeat Domain 55 antibody, WDR55, WDR-55, WDR 55, WDR-55 antibody, FLJ20195 antibody, WDR 55 antibody
Specificity WDR55 antibody was raised against the middle region of WDR55
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen WDR55 antibody was raised using the middle region of WDR55 corresponding to a region with amino acids AKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACG
Assay Information WDR55 Blocking Peptide, catalog no. 33R-1298, is also available for use as a blocking control in assays to test for specificity of this WDR55 antibody

Images

Western Blot analysis using WDR55 antibody (70R-3310)

WDR55 antibody (70R-3310) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WDR55 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WDR55 is a nucleolar protein that acts as a modulator of rRNA synthesis. WDR55 plays a central role during organogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using WDR55 antibody (70R-3310) | WDR55 antibody (70R-3310) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors