WDR6 antibody (70R-2628)

Rabbit polyclonal WDR6 antibody raised against the C terminal of WDR6

Synonyms Polyclonal WDR6 antibody, Anti-WDR6 antibody, Wd Repeat Domain 6 antibody, WDR6, WDR 6, WDR 6 antibody, WDR-6, WDR-6 antibody
Specificity WDR6 antibody was raised against the C terminal of WDR6
Cross Reactivity Human,Mouse
Applications IHC, WB
Immunogen WDR6 antibody was raised using the C terminal of WDR6 corresponding to a region with amino acids TPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLE
Assay Information WDR6 Blocking Peptide, catalog no. 33R-9232, is also available for use as a blocking control in assays to test for specificity of this WDR6 antibody


Immunohistochemical staining using WDR6 antibody (70R-2628)

WDR6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WDR6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WDR6 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using WDR6 antibody (70R-2628) | WDR6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X
  • Western Blot analysis using WDR6 antibody (70R-2628) | WDR6 antibody (70R-2628) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors