WDR63 antibody (70R-4155)

Rabbit polyclonal WDR63 antibody raised against the middle region of WDR63

Synonyms Polyclonal WDR63 antibody, Anti-WDR63 antibody, WDR 63, NYD-SP29 antibody, WDR 63 antibody, WDR63, Wd Repeat Domain 63 antibody, FLJ30067 antibody, WDR-63 antibody, WDR-63, RP11-507C22.2 antibody
Specificity WDR63 antibody was raised against the middle region of WDR63
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen WDR63 antibody was raised using the middle region of WDR63 corresponding to a region with amino acids EIALQQNEIMNTFIDDWKYLAEEEGTFGDKTDTHLKEYQSFTDLHSPTEK
Assay Information WDR63 Blocking Peptide, catalog no. 33R-2463, is also available for use as a blocking control in assays to test for specificity of this WDR63 antibody


Western Blot analysis using WDR63 antibody (70R-4155)

WDR63 antibody (70R-4155) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 103 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WDR63 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WDR63 contains 5 WD repeats. The exact function of WDR63 is not known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using WDR63 antibody (70R-4155) | WDR63 antibody (70R-4155) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors