WDR8 antibody (70R-2521)

Rabbit polyclonal WDR8 antibody raised against the middle region of WDR8

Synonyms Polyclonal WDR8 antibody, Anti-WDR8 antibody, MGC99569 antibody, WDR-8, WDR 8 antibody, Wd Repeat Domain 8 antibody, WDR 8, FLJ20430 antibody, WDR-8 antibody, WDR8
Specificity WDR8 antibody was raised against the middle region of WDR8
Cross Reactivity Human
Applications WB
Immunogen WDR8 antibody was raised using the middle region of WDR8 corresponding to a region with amino acids GCLSFPPPRAGAGPLPSSESKYEIASVPVSLQTLKPVTDRANPKMGIGML
Assay Information WDR8 Blocking Peptide, catalog no. 33R-3188, is also available for use as a blocking control in assays to test for specificity of this WDR8 antibody


Western Blot analysis using WDR8 antibody (70R-2521)

WDR8 antibody (70R-2521) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WDR8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using WDR8 antibody (70R-2521) | WDR8 antibody (70R-2521) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors