WNT16 antibody (70R-2001)

Rabbit polyclonal WNT16 antibody raised against the middle region of WNT16

Synonyms Polyclonal WNT16 antibody, Anti-WNT16 antibody, WNT-16, Wingless-Type Mmtv Integration Site Family Member 16 antibody, WNT 16 antibody, WNT 16, WNT-16 antibody, WNT16
Specificity WNT16 antibody was raised against the middle region of WNT16
Cross Reactivity Human
Applications WB
Immunogen WNT16 antibody was raised using the middle region of WNT16 corresponding to a region with amino acids KTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECN
Assay Information WNT16 Blocking Peptide, catalog no. 33R-4682, is also available for use as a blocking control in assays to test for specificity of this WNT16 antibody

Images

Western Blot analysis using WNT16 antibody (70R-2001)

WNT16 antibody (70R-2001) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WNT16 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WNT proteins are secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT16 contains two transcript variants diverging at the 5' termini. These two variants are proposed to be the products of separate promoters and not to be splice variants from a single promoter. They are differentially expressed in normal tissues, one of which (variant 2) is expressed at significant levels only in the pancreas, whereas another one (variant 1) is expressed more ubiquitously with highest levels in adult kidney, placenta, brain, heart, and spleen.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using WNT16 antibody (70R-2001) | WNT16 antibody (70R-2001) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors