WNT3 antibody (70R-4494)

Rabbit polyclonal WNT3 antibody raised against the middle region of WNT3

Synonyms Polyclonal WNT3 antibody, Anti-WNT3 antibody, INT4 antibody, WNT 3 antibody, WNT-3 antibody, MGC138323 antibody, MGC138321 antibody, WNT 3, MGC131950 antibody, WNT3, WNT-3, Wingless-Type Mmtv Integration Site Family Member 3 antibody
Specificity WNT3 antibody was raised against the middle region of WNT3
Cross Reactivity Human
Applications WB
Immunogen WNT3 antibody was raised using the middle region of WNT3 corresponding to a region with amino acids SHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRPDARSAMNKHNNE
Assay Information WNT3 Blocking Peptide, catalog no. 33R-8510, is also available for use as a blocking control in assays to test for specificity of this WNT3 antibody

Images

Western Blot analysis using WNT3 antibody (70R-4494)

WNT3 antibody (70R-4494) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WNT3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 98% amino acid identity to mouse Wnt3 protein, and 84% to human WNT3A protein, another WNT gene product.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using WNT3 antibody (70R-4494) | WNT3 antibody (70R-4494) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors