WWP2 antibody (70R-2202)

Rabbit polyclonal WWP2 antibody raised against the middle region of WWP2

Synonyms Polyclonal WWP2 antibody, Anti-WWP2 antibody, WWp2-like antibody, WWP 2 antibody, WWP2, WWP-2 antibody, WWP-2, Ww Domain Containing E3 Ubiquitin Protein Ligase 2 antibody, AIP2 antibody, WWP 2
Specificity WWP2 antibody was raised against the middle region of WWP2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen WWP2 antibody was raised using the middle region of WWP2 corresponding to a region with amino acids SSASTDHDPLGPLPPGWEKRQDNGRVYYVNHNTRTTQWEDPRTQGMIQEP
Assay Information WWP2 Blocking Peptide, catalog no. 33R-8788, is also available for use as a blocking control in assays to test for specificity of this WWP2 antibody


Western Blot analysis using WWP2 antibody (70R-2202)

WWP2 antibody (70R-2202) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 90 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of WWP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance WWP2 is a member of the NEDD4-like protein family. The family of proteins is known to possess ubiquitin-protein ligase activity. WWP2 contains 4 tandem WW domains. The WW domain is a protein motif consisting of 35 to 40 amino acids and is characterized by 4 conserved aromatic residues. The WW domain may mediate specific protein-protein interactions. This gene encodes a member of the NEDD4-like protein family. The family of proteins is known to possess ubiquitin-protein ligase activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using WWP2 antibody (70R-2202) | WWP2 antibody (70R-2202) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors