XPNPEP2 antibody (70R-5336)

Rabbit polyclonal XPNPEP2 antibody

Synonyms Polyclonal XPNPEP2 antibody, Anti-XPNPEP2 antibody, Aminopeptidase P2 antibody, XPNPEP 2, X-Prolyl Aminopeptidase antibody, XPNPEP-2 antibody, XPNPEP2, XPNPEP 2 antibody, XPNPEP-2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen XPNPEP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFS
Assay Information XPNPEP2 Blocking Peptide, catalog no. 33R-7464, is also available for use as a blocking control in assays to test for specificity of this XPNPEP2 antibody


Western Blot analysis using XPNPEP2 antibody (70R-5336)

XPNPEP2 antibody (70R-5336) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 75 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of XPNPEP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Aminopeptidase P is a hydrolase specific for N-terminal imido bonds, which are common to several collagen degradation products, neuropeptides, vasoactive peptides, and cytokines. Structurally, the enzyme is a member of the 'pita bread fold' family and occurs in mammalian tissues in both soluble and GPI-anchored membrane-bound forms. A membrane-bound and soluble form of this enzyme has been identified as products of two separate genes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using XPNPEP2 antibody (70R-5336) | XPNPEP2 antibody (70R-5336) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors