XRCC4 antibody (70R-2306)

Rabbit polyclonal XRCC4 antibody raised against the middle region of XRCC4

Synonyms Polyclonal XRCC4 antibody, Anti-XRCC4 antibody, XRCC 4 antibody, XRCC4, XRCC 4, XRCC-4, X-Ray Repair Complementing Defective Repair In Chinese Hamster Cells 4 antibody, XRCC-4 antibody
Specificity XRCC4 antibody was raised against the middle region of XRCC4
Cross Reactivity Human
Applications WB
Immunogen XRCC4 antibody was raised using the middle region of XRCC4 corresponding to a region with amino acids LQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRS
Assay Information XRCC4 Blocking Peptide, catalog no. 33R-5319, is also available for use as a blocking control in assays to test for specificity of this XRCC4 antibody


Western Blot analysis using XRCC4 antibody (70R-2306)

XRCC4 antibody (70R-2306) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of XRCC4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance XRCC4 functions together with DNA ligase IV and the DNA-dependent protein kinase in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. The non-homologous end-joining pathway is required both for normal development and for suppression of tumors. This gene functionally complements XR-1 Chinese hamster ovary cell mutant, which is impaired in DNA double-strand breaks produced by ionizing radiation and restriction enzymes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using XRCC4 antibody (70R-2306) | XRCC4 antibody (70R-2306) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors