XRCC5 antibody (70R-1235)

Rabbit polyclonal XRCC5 antibody

Synonyms Polyclonal XRCC5 antibody, Anti-XRCC5 antibody, XRCC-5, X-Ray Repair Complementing Defective Repair In Chinese Hamster Cells 5 antibody, XRCC 5, XRCC-5 antibody, XRCC5, XRCC 5 antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen XRCC5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDM
Assay Information XRCC5 Blocking Peptide, catalog no. 33R-3345, is also available for use as a blocking control in assays to test for specificity of this XRCC5 antibody


Immunohistochemical staining using XRCC5 antibody (70R-1235)

XRCC5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of pancreatic acinus (lndicated with Arrows) in Human Pancreas. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 83 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of XRCC5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance XRCC5 encodes the 80-kilodalton subunit of the Ku heterodimer protein which is also known as ATP-dependant DNA helicase II or DNA repair protein XRCC5. Ku is the DNA-binding component of the DNA-dependent protein kinase, and it functions together with the DNA ligase IV-XRCC4 complex in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. This gene functionally complements Chinese hamster xrs-6, a mutant defective in DNA double-strand break repair and in ability to undergo V(D)J recombination. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using XRCC5 antibody (70R-1235) | XRCC5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of pancreatic acinus (lndicated with Arrows) in Human Pancreas. Magnification is at 400X
  • Western Blot analysis using XRCC5 antibody (70R-1235) | XRCC5 antibody (70R-1235) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors