YARS antibody (70R-5037)

Rabbit polyclonal YARS antibody raised against the N terminal of YARS

Synonyms Polyclonal YARS antibody, Anti-YARS antibody, YTS antibody, CMTDIC antibody, Tyrosyl-tRNA Synthetase antibody, YRS antibody, TYRRS antibody
Specificity YARS antibody was raised against the N terminal of YARS
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen YARS antibody was raised using the N terminal of YARS corresponding to a region with amino acids MGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHV
Assay Information YARS Blocking Peptide, catalog no. 33R-6016, is also available for use as a blocking control in assays to test for specificity of this YARS antibody


Western Blot analysis using YARS antibody (70R-5037)

YARS antibody (70R-5037) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of YARS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Tyrosyl-tRNA synthetase belongs to the class I tRNA synthetase family. Cytokine activities have also been observed for the human tyrosyl-tRNA synthetase, after it is split into two parts, an N-terminal fragment that harbors the catalytic site and a C-terminal fragment found only in the mammalian enzyme. The N-terminal fragment is an interleukin-8-like cytokine, whereas the released C-terminal fragment is an EMAP II-like cytokine.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using YARS antibody (70R-5037) | YARS antibody (70R-5037) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors