YTHDF1 antibody (70R-1989)

Rabbit polyclonal YTHDF1 antibody raised against the middle region of YTHDF1

Synonyms Polyclonal YTHDF1 antibody, Anti-YTHDF1 antibody, Yth Domain Family Member 1 antibody, YTHDF-1, C20orf21 antibody, YTHDF 1, YTHDF-1 antibody, YTHDF 1 antibody, YTHDF1, FLJ20391 antibody
Specificity YTHDF1 antibody was raised against the middle region of YTHDF1
Cross Reactivity Human
Applications WB
Immunogen YTHDF1 antibody was raised using the middle region of YTHDF1 corresponding to a region with amino acids QQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNA
Assay Information YTHDF1 Blocking Peptide, catalog no. 33R-7688, is also available for use as a blocking control in assays to test for specificity of this YTHDF1 antibody


Western Blot analysis using YTHDF1 antibody (70R-1989)

YTHDF1 antibody (70R-1989) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of YTHDF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of YTHDF1 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using YTHDF1 antibody (70R-1989) | YTHDF1 antibody (70R-1989) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors