YWHAZ antibody (70R-1251)

Rabbit polyclonal YWHAZ antibody raised against the C terminal of YWHAZ

Synonyms Polyclonal YWHAZ antibody, Anti-YWHAZ antibody, MGC126532 antibody, KCIP-1 antibody, MGC111427 antibody, MGC138156 antibody, Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein antibody
Specificity YWHAZ antibody was raised against the C terminal of YWHAZ
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen YWHAZ antibody was raised using the C terminal of YWHAZ corresponding to a region with amino acids AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGE
Assay Information YWHAZ Blocking Peptide, catalog no. 33R-1158, is also available for use as a blocking control in assays to test for specificity of this YWHAZ antibody


Western Blot analysis using YWHAZ antibody (70R-1251)

YWHAZ antibody (70R-1251) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of YWHAZ antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance YWHAZ belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using YWHAZ antibody (70R-1251) | YWHAZ antibody (70R-1251) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors