YWHAZ antibody (70R-3632)

Rabbit polyclonal YWHAZ antibody raised against the middle region of Ywhaz

Synonyms Polyclonal YWHAZ antibody, Anti-YWHAZ antibody, KCIP-1 antibody, MGC126532 antibody, MGC111427 antibody, MGC138156 antibody, Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein antibody
Specificity YWHAZ antibody was raised against the middle region of Ywhaz
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen YWHAZ antibody was raised using the middle region of Ywhaz corresponding to a region with amino acids FDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
Assay Information YWHAZ Blocking Peptide, catalog no. 33R-2862, is also available for use as a blocking control in assays to test for specificity of this YWHAZ antibody

Images

Western blot analysis using YWHAZ antibody (70R-3632)

Recommended YWHAZ Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of YWHAZ antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance YWHAZ belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using YWHAZ antibody (70R-3632) | Recommended YWHAZ Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using YWHAZ antibody (70R-3632) | Liver

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors