ZCCHC12 antibody (70R-2560)

Rabbit polyclonal ZCCHC12 antibody raised against the N terminal of ZCCHC12

Synonyms Polyclonal ZCCHC12 antibody, Anti-ZCCHC12 antibody, ZCCHC-12 antibody, FLJ16123 antibody, SIZN antibody, Zinc Finger Cchc Domain Containing 12 antibody, ZCCHC 12 antibody, ZCCHC12, ZCCHC-12, ZCCHC 12
Specificity ZCCHC12 antibody was raised against the N terminal of ZCCHC12
Cross Reactivity Human
Applications WB
Immunogen ZCCHC12 antibody was raised using the N terminal of ZCCHC12 corresponding to a region with amino acids AREVMRVLQATNPNLSVADFLRAMKLVFGESESSVTAHGKFFNTLQAQGE
Assay Information ZCCHC12 Blocking Peptide, catalog no. 33R-1469, is also available for use as a blocking control in assays to test for specificity of this ZCCHC12 antibody


Western Blot analysis using ZCCHC12 antibody (70R-2560)

ZCCHC12 antibody (70R-2560) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZCCHC12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZCCHC12 contains 1 CCHC-type zinc finger. ZCCHC12 is the transcriptional coactivator in the bone morphogenetic protein (BMP)-signaling pathway. It positively modulates BMP signaling by interacting with SMAD1 and associating with CBP in the transcription complex. It contributes to the BMP-induced enhancement of cholinergic-neuron-specific gene expression.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ZCCHC12 antibody (70R-2560) | ZCCHC12 antibody (70R-2560) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors