ZCCHC14 antibody (70R-4234)

Rabbit polyclonal ZCCHC14 antibody raised against the N terminal of ZCCHC14

Synonyms Polyclonal ZCCHC14 antibody, Anti-ZCCHC14 antibody, Zinc Finger Cchc Domain Containing 14 antibody, ZCCHC 14, MGC126527 antibody, ZCCHC14, BDG29 antibody, MGC14139 antibody, ZCCHC-14 antibody, BDG-29 antibody, ZCCHC 14 antibody, ZCCHC-14
Specificity ZCCHC14 antibody was raised against the N terminal of ZCCHC14
Cross Reactivity Human
Applications WB
Immunogen ZCCHC14 antibody was raised using the N terminal of ZCCHC14 corresponding to a region with amino acids RYLASLPSHVLKNDHVRRFLSTSSPPQQLQSPSPGNPSLSKVGTVMGVSG
Assay Information ZCCHC14 Blocking Peptide, catalog no. 33R-8278, is also available for use as a blocking control in assays to test for specificity of this ZCCHC14 antibody


Western Blot analysis using ZCCHC14 antibody (70R-4234)

ZCCHC14 antibody (70R-4234) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 100 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZCCHC14 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZCCHC14 contains 1 CCHC-type zinc finger. The function of ZCCHC14 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ZCCHC14 antibody (70R-4234) | ZCCHC14 antibody (70R-4234) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors