ZDHHC13 antibody (70R-1661)

Rabbit polyclonal ZDHHC13 antibody raised against the N terminal of ZDHHC13

Synonyms Polyclonal ZDHHC13 antibody, Anti-ZDHHC13 antibody, Zinc Finger Dhhc-Type Containing 13 antibody, MGC64994 antibody, HIP3RP antibody, HIP14L antibody, ZDHHC13, FLJ10852 antibody, ZDHHC 13 antibody, ZDHHC-13, ZDHHC-13 antibody, ZDHHC 13, FLJ10941 antibody
Specificity ZDHHC13 antibody was raised against the N terminal of ZDHHC13
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen ZDHHC13 antibody was raised using the N terminal of ZDHHC13 corresponding to a region with amino acids MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV
Assay Information ZDHHC13 Blocking Peptide, catalog no. 33R-6586, is also available for use as a blocking control in assays to test for specificity of this ZDHHC13 antibody


Immunohistochemical staining using ZDHHC13 antibody (70R-1661)

ZDHHC13 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ZDHHC13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZDHHC13 may be involved in the NF-kappa-B signaling pathway.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using ZDHHC13 antibody (70R-1661) | ZDHHC13 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X
  • Western Blot analysis using ZDHHC13 antibody (70R-1661) | ZDHHC13 antibody (70R-1661) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors