ZDHHC17 antibody (70R-1832)

Rabbit polyclonal ZDHHC17 antibody raised against the middle region of ZDHHC17

Synonyms Polyclonal ZDHHC17 antibody, Anti-ZDHHC17 antibody, Zinc Finger Dhhc-Type Containing 17 antibody, KIAA0946 antibody, HYPH antibody, HIP14 antibody, HIP3 antibody, HSPC294 antibody, ZDHHC-17, ZDHHC17, ZDHHC 17 antibody, ZDHHC 17, ZDHHC-17 antibody
Specificity ZDHHC17 antibody was raised against the middle region of ZDHHC17
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ZDHHC17 antibody was raised using the middle region of ZDHHC17 corresponding to a region with amino acids FLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL
Assay Information ZDHHC17 Blocking Peptide, catalog no. 33R-2993, is also available for use as a blocking control in assays to test for specificity of this ZDHHC17 antibody


Western Blot analysis using ZDHHC17 antibody (70R-1832)

ZDHHC17 antibody (70R-1832) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ZDHHC17 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZDHHC17 is a palmitoyltransferase specific for a subset of neuronal proteins, including SNAP25, DLG4/PSD95, GAD2, SYT1 and HD. It may be involved in the sorting or targeting of critical proteins involved in the initiating events of endocytosis at the plasma membrane. It may be involved in the NF-kappa-B signaling pathway and has transforming activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ZDHHC17 antibody (70R-1832) | ZDHHC17 antibody (70R-1832) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors