ZFYVE27 antibody (70R-1729)

Rabbit polyclonal ZFYVE27 antibody raised against the middle region of ZFYVE27

Synonyms Polyclonal ZFYVE27 antibody, Anti-ZFYVE27 antibody, ZFYVE 27 antibody, ZFYVE-27 antibody, ZFYVE-27, RP11-459F3.2 antibody, SPG33 antibody, ZFYVE 27, ZFYVE27, Zinc Finger Fyve Domain Containing 27 antibody
Specificity ZFYVE27 antibody was raised against the middle region of ZFYVE27
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen ZFYVE27 antibody was raised using the middle region of ZFYVE27 corresponding to a region with amino acids VGGKDGLMDSTPALTPTESLSSQDLTPGSVEEAEEAEPDEEFKDAIEETH
Assay Information ZFYVE27 Blocking Peptide, catalog no. 33R-9554, is also available for use as a blocking control in assays to test for specificity of this ZFYVE27 antibody

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ZFYVE27 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZFYVE27 may be associated with the neuronal intracellular trafficking in the corticospinal tract, which is consistent with the pathology of HSP.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors