ZG16 antibody (70R-5441)

Rabbit polyclonal ZG16 antibody raised against the middle region of ZG16

Synonyms Polyclonal ZG16 antibody, Anti-ZG16 antibody, MGC34820 antibody, Zymogen Granule Protein 16 antibody, ZG-16 antibody, ZG 16 antibody, ZG 16, ZG-16, ZG16
Specificity ZG16 antibody was raised against the middle region of ZG16
Cross Reactivity Human
Applications WB
Immunogen ZG16 antibody was raised using the middle region of ZG16 corresponding to a region with amino acids WSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFG
Assay Information ZG16 Blocking Peptide, catalog no. 33R-10009, is also available for use as a blocking control in assays to test for specificity of this ZG16 antibody


Western Blot analysis using ZG16 antibody (70R-5441)

ZG16 antibody (70R-5441) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZG16 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZG16 may act as a linker molecule between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins during granule formation in the TGN.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ZG16 antibody (70R-5441) | ZG16 antibody (70R-5441) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors