ZGPAT antibody (70R-3510)

Rabbit polyclonal ZGPAT antibody raised against the C terminal of ZGPAT

Synonyms Polyclonal ZGPAT antibody, Anti-ZGPAT antibody, Zinc Finger Ccch-Type With G Patch Domain antibody, ZC3HDC9 antibody, GPATCH6 antibody, KIAA1847 antibody, ZC3H9 antibody, GPATC6 antibody, MGC44880 antibody
Specificity ZGPAT antibody was raised against the C terminal of ZGPAT
Cross Reactivity Human
Applications WB
Immunogen ZGPAT antibody was raised using the C terminal of ZGPAT corresponding to a region with amino acids AGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF
Assay Information ZGPAT Blocking Peptide, catalog no. 33R-1217, is also available for use as a blocking control in assays to test for specificity of this ZGPAT antibody

Images

Western Blot analysis using ZGPAT antibody (70R-3510)

ZGPAT antibody (70R-3510) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZGPAT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZGPAT contains 1 C3H1-type zinc finger and 1 G-patch domain. The function of the ZGPAT protein is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ZGPAT antibody (70R-3510) | ZGPAT antibody (70R-3510) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors